PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00014504-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MYB_related
Protein Properties Length: 76aa    MW: 8605.56 Da    PI: 7.5097
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00014504-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding21.84.3e-072259544
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
   Myb_DNA-binding  5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
                      + +E++l+ +++++lG + W++Ia +++  R ++++ ++ 
  PSME_00014504-RA 22 SSDEQDLINRLHNLLGDK-WALIAGRLP-WRRPEEIENYC 59
                      679*************99.*********.99998887775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.00571765IPR001005SANT/Myb domain
SuperFamilySSF466891.97E-52060IPR009057Homeodomain-like
PROSITE profilePS500906.0982267IPR017877Myb-like domain
CDDcd001677.46E-42263No hitNo description
Gene3DG3DSA:1.10.10.602.6E-82259IPR009057Homeodomain-like
PfamPF002492.3E-62260IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 76 aa     Download sequence    Send to blast
MGGSSVEYSK KSACAAPDHD ISSDEQDLIN RLHNLLGDKW ALIAGRLPWR RPEEIENYCK  60
TRWQAGYTLH TSSSRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1093623e-49BT109362.1 Picea glauca clone GQ03207_J20 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA9NQX02e-17A9NQX0_PICSI; Putative uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46410.19e-14MYB_related family protein